PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_1044_iso_5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family VOZ
Protein Properties Length: 196aa    MW: 22795.4 Da    PI: 9.1003
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_1044_iso_5genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ250.82.2e-771113692217
                                  VOZ  92 aaelfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssf 165
                                           +elfdl++legetirewlffdkprrafesgnrkqrslpdy+grgwhesrkqvm+efgglkrsyymdpqp++s+
  cra_locus_1044_iso_5_len_1269_ver_3  11 GTELFDLAVLEGETIREWLFFDKPRRAFESGNRKQRSLPDYNGRGWHESRKQVMNEFGGLKRSYYMDPQPMKSY 84 
                                          58************************************************************************ PP

                                  VOZ 166 ewhlyeyeineldalalyrlelklvdekksakgkvskdsladlqkklgrlta 217
                                          ewhlyeyein++d +alyrlelklvd+kks+kgkv++ds++dlqk++ +lta
  cra_locus_1044_iso_5_len_1269_ver_3  85 EWHLYEYEINKYDVCALYRLELKLVDGKKSPKGKVANDSVSDLQKQMKKLTA 136
                                          **************************************************97 PP

Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009408Biological Processresponse to heat
GO:0009414Biological Processresponse to water deprivation
GO:0009631Biological Processcold acclimation
GO:0009816Biological Processdefense response to bacterium, incompatible interaction
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048578Biological Processpositive regulation of long-day photoperiodism, flowering
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 196 aa     Download sequence    Send to blast
XSLSLSFFFF GTELFDLAVL EGETIREWLF FDKPRRAFES GNRKQRSLPD YNGRGWHESR  60
KQVMNEFGGL KRSYYMDPQP MKSYEWHLYE YEINKYDVCA LYRLELKLVD GKKSPKGKVA  120
NDSVSDLQKQ MKKLTAEFPS DNKRTVKGNS KANTKDVNGS IHSNPNRMPQ TNEAFDYGTG  180
APFEYLVDNL NGYYIT
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009589156.11e-108PREDICTED: transcription factor VOZ1-like
RefseqXP_009589157.11e-108PREDICTED: transcription factor VOZ1-like
SwissprotQ9SGQ01e-89VOZ1_ARATH; Transcription factor VOZ1
TrEMBLA0A068TU111e-115A0A068TU11_COFCA; Uncharacterized protein
STRINGPGSC0003DMT4000587351e-102(Solanum tuberosum)